DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and CG5906

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster


Alignment Length:214 Identity:104/214 - (48%)
Similarity:138/214 - (64%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SLRMSWPRNSSATGGAGGAAPGGGSSTTTSTIGFGALQKLREWHASAFSSRFLLFTNVGISLTLS 87
            :||:.|.|.::|                           :..:|..|||.::|||||:|||:.||
  Fly     2 ALRVLWRRMTNA---------------------------MDRFHQIAFSPKYLLFTNIGISVGLS 39

  Fly    88 CVGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGVICHYWYKMLDKRMPGRTMRVVAKKIVLD 152
            .|||.:||..|...||:..:..|||..|.|||:|||::|||||:.||...|.||.:||..||:||
  Fly    40 MVGDTMEQSYERLIGELPDWNRTRTIRMGISGLTVGLVCHYWYQHLDYLFPKRTYKVVVVKILLD 104

  Fly   153 QLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYRIFY 217
            |.||||.||:.||:|:.:||..|..|:.:||:|||..||||||||||:|||:||..|...||:||
  Fly   105 QFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFY 169

  Fly   218 DNIISLGYDVLTSKVKHKQ 236
            ||.||||||:.||:||:::
  Fly   170 DNTISLGYDIYTSQVKYRK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 40/63 (63%)
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 39/62 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448736
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 1 1.000 - - H13093
Inparanoid 1 1.050 62 1.000 Inparanoid score I2532
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104780at33392
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm25042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2546
1110.900

Return to query results.
Submit another query.