DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and CG32262

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_647831.1 Gene:CG32262 / 38445 FlyBaseID:FBgn0052262 Length:273 Species:Drosophila melanogaster


Alignment Length:239 Identity:80/239 - (33%)
Similarity:122/239 - (51%) Gaps:23/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SRAIRGQRSLRMSWPRNS---------SATGGAGGAAPG-----GGSSTTTSTIGFGALQKLREW 65
            :|.:|...|||:....||         ..:.|.|....|     |...|....:.|..|:    |
  Fly     4 TRCLRQCYSLRIHGSHNSRRDFAALCRMRSHGVGYQKYGLRFTHGKGETEGGALSFILLR----W 64

  Fly    66 HASAFSS---RFLLFTNVGISLTLSCVGDVLEQHLEIYCG--EIERFESTRTAHMAISGVTVGVI 125
            ...|:|:   ::||.|||..|..|..||||:.|..|...|  ..:||::.|...|.::|...|.:
  Fly    65 TKIAWSNMFGKYLLVTNVVGSGLLMVVGDVIAQEYEYRRGLRHQDRFDTDRMYRMFVAGALQGPL 129

  Fly   126 CHYWYKMLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKL 190
            .||.|..:|:.||.||::.:.|||::|||:.||..|..||.:|..||::|.....:|:..|...:
  Fly   130 HHYVYNWMDRVMPARTLKNIFKKILIDQLVMSPACIVIFFYSLCYLERQTLDATNQELISKFPYV 194

  Fly   191 YAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKH 234
            |..:|..||.||::||.::.|.||:.:.|:.:..|:||.|.:||
  Fly   195 YMLDWMTWPAAQYLNFRYLDTKYRVTFVNVCTAVYNVLMSYMKH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 21/63 (33%)
CG32262NP_647831.1 Mpv17_PMP22 175..238 CDD:282035 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463132
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2532
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104780at33392
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm3031
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 1 1.000 - - X2546
1211.830

Return to query results.
Submit another query.