DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and CG7970

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001303378.1 Gene:CG7970 / 38205 FlyBaseID:FBgn0035252 Length:255 Species:Drosophila melanogaster


Alignment Length:118 Identity:31/118 - (26%)
Similarity:60/118 - (50%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GVICHYWYKMLDKRMPGRTMRVVAKKIVL---DQLICSPIY--ISAFFVTLGLLEQKTKHEVWEE 182
            |.:.||:|..:: |:..:.:|.  ::..|   ::|:.:|||  :|.||  |.|.|.|:.....:.
  Fly   131 GSVPHYFYTTVE-RLFSQDVRF--RRFFLFLSERLVYAPIYQALSLFF--LALFEGKSPSTALKN 190

  Fly   183 IKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHK 235
            :::..|.|..|.|....|..::||.::|..:|.....|||..:.|..::.:.:
  Fly   191 VEKLYWPLLKANWQYLSVFVYLNFAYVPPMFRSISMAIISFIWVVYIAQKRRR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 16/63 (25%)
CG7970NP_001303378.1 Mpv17_PMP22 178..238 CDD:282035 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463146
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.