DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and Mpv17

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_038968365.1 Gene:Mpv17 / 360463 RGDID:1310512 Length:207 Species:Rattus norvegicus


Alignment Length:159 Identity:45/159 - (28%)
Similarity:81/159 - (50%) Gaps:2/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGV-TVGVICHYWYKMLDKRMPGRT 141
            |:|..:.:|..:||::.|.|....| :::.::.||..||..|. .||.:...||::||..:||.|
  Rat    49 THVPCTGSLMGLGDIISQQLVERRG-LQQHQTGRTLTMASLGCGFVGPVVGGWYRVLDHLIPGTT 112

  Fly   142 MRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNF 206
            .....||::|||...:|.::..|...:|:|...:..:.|.::|..........:.:||..|..||
  Rat   113 KVNALKKMLLDQGGFAPCFLGCFLPLVGVLNGMSAQDNWAKLKRDYPDALITNYYLWPAVQLANF 177

  Fly   207 YWIPTHYRIFYDNIISLGYDVLTSKVKHK 235
            |.:|.|||:.....:::.::...|...|:
  Rat   178 YLVPLHYRLAVVQCVAVVWNSYLSWKAHQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 14/63 (22%)
Mpv17XP_038968365.1 Mpv17_PMP22 140..201 CDD:397992 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.