DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and T18D3.9

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001024916.1 Gene:T18D3.9 / 3564939 WormBaseID:WBGene00011826 Length:181 Species:Caenorhabditis elegans


Alignment Length:161 Identity:44/161 - (27%)
Similarity:82/161 - (50%) Gaps:5/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LFTNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMA-ISGVTVGVICHYWYKMLDKRMPG 139
            |.|.:.|:.|:|..||.|.|    |....:.::..|||..: :|...:......|:::|:|....
 Worm    16 LSTQMCIAGTISGSGDCLAQ----YLSHNQEWDRWRTARFSFLSSCFMAPSLFIWFRLLEKVKGN 76

  Fly   140 RTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFV 204
            ....::.||:.:|||..||.:.:|....|.||:.::..:.|:.:||..:.:||....|||..|.|
 Worm    77 NKSLLLVKKLCIDQLCFSPCFNAAILFNLRLLQHQSAEKSWDLLKEDWFNIYATSLKVWPFVQVV 141

  Fly   205 NFYWIPTHYRIFYDNIISLGYDVLTSKVKHK 235
            |..::|.:||:..:.:::..::...|.:..|
 Worm   142 NLCFVPLNYRVILNQVVAFFWNCYLSYITQK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 17/63 (27%)
T18D3.9NP_001024916.1 Mpv17_PMP22 107..171 CDD:282035 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.