DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and Pxmp2

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_038945225.1 Gene:Pxmp2 / 29533 RGDID:61812 Length:227 Species:Rattus norvegicus


Alignment Length:201 Identity:44/201 - (21%)
Similarity:79/201 - (39%) Gaps:56/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SRFLLF-------TNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGV--------- 120
            :::|||       |....|..||.:|::|.|       .||:.:...:..:.:||:         
  Rat    23 AQYLLFLKFYPVVTKAVSSGILSALGNLLAQ-------MIEKKQKKDSRSLEVSGLLRYLVYGLF 80

  Fly   121 TVGVICHYWYKMLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKT---------- 175
            ..|.:.||.|..::..:|........|:::||:|..:|.::..||..:.|||..:          
  Rat    81 VTGPLSHYLYLFMEYWVPPEVPWARVKRLLLDRLFFAPTFLLLFFFVMNLLEVLSQAWWLVPVIA 145

  Fly   176 -----------KHEVWEEIKEK------------AWKLYAAEWTVWPVAQFVNFYWIPTHYRIFY 217
                       |.:|..|.|.|            .|......|.:|...||:|..::|..:|:.:
  Rat   146 ILRRLRKEDYHKFKVILEYKGKNISVFVAKMRSGFWPALQMNWRMWTPLQFININYVPLQFRVLF 210

  Fly   218 DNIISL 223
            .|:.:|
  Rat   211 ANMAAL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 18/87 (21%)
Pxmp2XP_038945225.1 Mpv17_PMP22 165..223 CDD:397992 12/52 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.