DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and CG12355

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster


Alignment Length:211 Identity:48/211 - (22%)
Similarity:84/211 - (39%) Gaps:45/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSRAIRGQRSLRMSWPRNSSATGGAGGAAPGGGSSTTTSTIGFGALQKLREWHASAFSSRFLLFT 78
            ::|.|.|.|:|...:|                  ..|.|.| :|:|....|:.....|.|:|...
  Fly     1 MARLISGVRNLFHRYP------------------FVTNSAI-YGSLYVGAEYSQQFASKRWLATA 46

  Fly    79 NVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGVTV-GVICHYWYKMLDKRMPGRTM 142
            :....:..:.:|                       ..|:.|..| ....:.|||.||:..||.|.
  Fly    47 SKPEDIDYATIG-----------------------RYAVMGTAVYAPTLYLWYKWLDRAFPGTTK 88

  Fly   143 RVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNFY 207
            .::.||:||||.:.:|..::.|:..:.::|...  :::.|::||....:......|..||.:||.
  Fly    89 VIIVKKLVLDQFVLTPYLLTVFYAGMSIMEGSA--DIFLELREKFVPTFMRSCIFWLPAQALNFS 151

  Fly   208 WIPTHYRIFYDNIISL 223
            .:...:|:.|..|..|
  Fly   152 LVAPRFRVIYMGICGL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 13/54 (24%)
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.