DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and MPV17L

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_016878597.1 Gene:MPV17L / 255027 HGNCID:26827 Length:198 Species:Homo sapiens


Alignment Length:184 Identity:54/184 - (29%)
Similarity:80/184 - (43%) Gaps:32/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RGCP--ARGLILSRAIRGQRSLRMSWPRN-SSATGGA---------------GGAAPGGGSSTTT 51
            |..|  ||||.:     |:|.|.:....| |.|:||.               |...||.|.....
Human    14 RSAPRTARGLRI-----GRRELGVCGSLNRSGASGGGRCRCRLLQCSSCWRLGRPGPGAGRRRPR 73

  Fly    52 STIGFGA--LQKLREWHA-SAFSSRFLLFTNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTA 113
            ..:..||  ......|.| |..:.|....|||.:..:|...||.|:|.|:   |....:..||  
Human    74 GLLIAGAHSADMAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQ---GREANWRQTR-- 133

  Fly   114 HMAISGVTVGVICHY-WYKMLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFV 166
            .:|...||.....:| |.::|::.:|||....:..|::.||::.:||.:|||:|
Human   134 RVATLVVTFHANFNYVWLRLLERALPGRAPHALLAKLLCDQVVGAPIAVSAFYV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035
MPV17LXP_016878597.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.