DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and SPAC3G6.05

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_594971.1 Gene:SPAC3G6.05 / 2543194 PomBaseID:SPAC3G6.05 Length:206 Species:Schizosaccharomyces pombe


Alignment Length:194 Identity:45/194 - (23%)
Similarity:81/194 - (41%) Gaps:45/194 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SAFSSRF-LLFTNVGISL------TLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGV- 124
            |.|::|: .||....|..      ||..:.|.:.|.|.||       ::.:.|.:.:.||.:.. 
pombe     3 SRFATRYNALFEKAPIMTMCLTAGTLGGISDAVAQGLTIY-------QTNKNAMIGLDGVRLNTH 60

  Fly   125 --------ICHY-------------WYKMLDKRMPGRTMRV-VAKKIVLDQLICSPIYISAFFVT 167
                    :..:             |.::|..:.|.....: |.|:::|||.:.:|...:.||..
pombe    61 PEIPSIKRVLQFVTFGFAISPFQFRWLRLLSAKFPIEKGAINVVKRVLLDQAVFAPFGTAFFFSW 125

  Fly   168 LGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYR--------IFYDNIISL 223
            :.|.|.|.....:::::...|....|.:.|||..|.|||:.:|..|:        ||::..:||
pombe   126 MTLAEGKGFRGAYDKLQAVFWPTLKANYMVWPFFQTVNFWLMPLQYQMPFACTVAIFWNIFLSL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 18/62 (29%)
SPAC3G6.05NP_594971.1 Mpv17_PMP22 128..192 CDD:282035 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.