DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and Mpv17l2

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_898993.1 Gene:Mpv17l2 / 234384 MGIID:2681846 Length:200 Species:Mus musculus


Alignment Length:173 Identity:67/173 - (38%)
Similarity:98/173 - (56%) Gaps:13/173 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FSSRFLLFTNVGISLTLSC-----VGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGVICHYW 129
            |..|.||.||     ||.|     .||...|..|:.....:||.:.|:|.|...|.::|...|:|
Mouse    20 FQGRALLLTN-----TLGCGVLMAAGDGARQVWEVRARPGQRFSARRSASMFAVGCSMGPFLHFW 79

  Fly   130 YKMLDKRMPG---RTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLY 191
            |..||:.:|.   |::..|.||:::||.:.|||....:|:.||.||.:|..|..:|::.|.|..|
Mouse    80 YLWLDRLLPASGLRSLPSVMKKVLVDQTVASPILGVWYFLGLGSLEGQTLEESCQELRAKFWDFY 144

  Fly   192 AAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKH 234
            .|:|.|||.||.|||.:||:|:|:.|.|.::||:|...|.:|:
Mouse   145 KADWCVWPAAQLVNFLFIPSHFRVTYINGLTLGWDTYLSYLKY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 28/63 (44%)
Mpv17l2NP_898993.1 Mpv17_PMP22 124..186 CDD:282035 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836944
Domainoid 1 1.000 69 1.000 Domainoid score I9611
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13093
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 1 1.000 - - X2546
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.