DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and ZK470.1

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_508708.3 Gene:ZK470.1 / 191323 WormBaseID:WBGene00022744 Length:180 Species:Caenorhabditis elegans


Alignment Length:176 Identity:58/176 - (32%)
Similarity:99/176 - (56%) Gaps:11/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FSSRFLLFTNVGISLTLSCVGDVLEQHLEIYCGEIER--FESTRTAHMAISGVTVGVICHYWYKM 132
            |.:|.||.||||.|.......|:::||:.   |:::|  ::..||..||..|:.:....|.:|::
 Worm     8 FLARHLLLTNVGTSCAQIGTADIIQQHIN---GDVDRDGWDWRRTCRMAAIGLVMAPSLHCFYRV 69

  Fly   133 LDKR--MPGRTMRVVAKKIVLDQLICSPIYISAFFVTLG-LLEQKTKHEVWEEIKEKAWKLYAAE 194
            ||.|  :..|..:|: ||:..|.....  |.|..|:|:| :.|.|:....:.|.:.|.|.::..:
 Worm    70 LDTRKFIGSRNCKVL-KKLAWDTAFIP--YFSCIFMTVGSIYEGKSLSAAFAEYRRKMWHIWKVD 131

  Fly   195 WTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHKQSHSH 240
            :|:||.||.:|||::|...|:.|.|::||.|:.:.|.:|:.:.|.|
 Worm   132 FTLWPPAQLINFYFMPPALRVVYVNLVSLLYNCIMSYIKNNELHHH 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 21/63 (33%)
ZK470.1NP_508708.3 Nuc-transf <27..>54 CDD:294849 8/29 (28%)
Mpv17_PMP22 109..171 CDD:282035 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159186
Domainoid 1 1.000 54 1.000 Domainoid score I7511
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13093
Inparanoid 1 1.050 102 1.000 Inparanoid score I3550
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29367
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm14683
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 1 1.000 - - X2546
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.