DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and Mpv17

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001297457.1 Gene:Mpv17 / 17527 MGIID:97138 Length:178 Species:Mus musculus


Alignment Length:154 Identity:45/154 - (29%)
Similarity:76/154 - (49%) Gaps:4/154 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGV-TVGVICHYWYKMLDKRMPGRTMRVVAKK 148
            :|..|||::.|.|....| :::.::.||..|...|. .||.:...|||:||..:||.|.....||
Mouse    25 SLMGVGDMISQQLVERRG-LQQHQAGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKK 88

  Fly   149 IVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTV--WPVAQFVNFYWIPT 211
            ::|||...:|.::..|...:|:|...:..:.|.::|..........:.|  ||..|..|||.:|.
Mouse    89 MLLDQGGFAPCFLGCFLPLVGILNGMSAQDNWAKLKRDYPDALITNYYVRLWPAVQLANFYLVPL 153

  Fly   212 HYRIFYDNIISLGYDVLTSKVKHK 235
            |||:.....:::.::...|...|:
Mouse   154 HYRLAVVQCVAIVWNSYLSWKAHQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 15/65 (23%)
Mpv17NP_001297457.1 Mpv17_PMP22 110..176 CDD:282035 15/65 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.