DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and LOC100497159

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_002934856.2 Gene:LOC100497159 / 100497159 -ID:- Length:213 Species:Xenopus tropicalis


Alignment Length:171 Identity:67/171 - (39%)
Similarity:104/171 - (60%) Gaps:0/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FSSRFLLFTNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGVICHYWYKMLD 134
            |:.:.||.||...:..|...||.::|..|:...:.::.:..||..|...|..:|.:.||||..||
 Frog    20 FTGQTLLITNTVSAGVLLSTGDAIQQTWEMRRNKEKKRDWLRTGRMFAIGCCLGPVDHYWYVFLD 84

  Fly   135 KRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWP 199
            :.:||.|:|||.||::::|::.|||..:.||:..||:|..:..|.|.|.|.|.|::|..||.|||
 Frog    85 RILPGATVRVVLKKVLVEQIVASPILGTMFFMGTGLMEGHSVEESWVEFKGKFWEMYKVEWCVWP 149

  Fly   200 VAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHKQSHSH 240
            .||.:|||::||.||:.|.|.::|.:|:....:|||...:|
 Frog   150 PAQIINFYFLPTKYRVMYVNFVTLAWDIYLCYLKHKNPVTH 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 27/63 (43%)
LOC100497159XP_002934856.2 Mpv17_PMP22 119..180 CDD:367825 28/60 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8960
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4305
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - mtm9359
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2546
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.