DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and mpv17l

DIOPT Version :10

Sequence 1:NP_572883.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_002938322.1 Gene:mpv17l / 100493944 XenbaseID:XB-GENE-5755324 Length:203 Species:Xenopus tropicalis


Alignment Length:182 Identity:56/182 - (30%)
Similarity:89/182 - (48%) Gaps:25/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FSSRFLLFTNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGVICH-----YW 129
            |:.|....|||.|..:|....|:::|.|....||...|:  :||.:.|    ||...|     :|
 Frog     7 FTKRHPWLTNVTIYGSLFASADIVQQKLSKSPGEPIDFK--QTAKVGI----VGFCFHANFNFFW 65

  Fly   130 YKMLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAE 194
            .:.:::..||.....|.:|:..|||:.:||.||||:..|.||:.::  ::::.:|||.|..|...
 Frog    66 LRFIERTFPGSAPLNVIRKVACDQLMAAPITISAFYTGLSLLDGES--DIFKNLKEKFWPTYKTG 128

  Fly   195 WTVWPVAQFVNFYWIPTHYRIFYDNIIS------LGY----DV--LTSKVKH 234
            ...|.|.|.:||..||...|..|..:.:      |.|    |:  :||::.|
 Frog   129 VMCWTVFQTINFSVIPPFVRTAYIGVCAFLWTTFLCYIRNRDINEVTSRLLH 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_572883.1 Mpv17_PMP22 169..230 CDD:461182 19/72 (26%)
mpv17lXP_002938322.1 Mpv17_PMP22 105..164 CDD:461182 16/60 (27%)

Return to query results.
Submit another query.