DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and Mpv17l

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_008765688.1 Gene:Mpv17l / 100362572 RGDID:2324483 Length:194 Species:Rattus norvegicus


Alignment Length:143 Identity:42/143 - (29%)
Similarity:76/143 - (53%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGVICHYWYKMLDKRMPGRTM 142
            |||.:...|...||.|:|.|.  .|..:..::.|.|.:|::  ..|...:.|.::|::.:|||..
  Rat    19 TNVLLYAGLFSAGDALQQRLR--GGPADWRQTRRVATLALT--FHGNFNYMWLRLLERALPGRAP 79

  Fly   143 RVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNFY 207
            |.|..|::.||.:..|:.:|||:|.:.:|:  .|.:::.::::|.|..|......||..|..||.
  Rat    80 RTVLAKVLCDQTVGGPVALSAFYVGMSILQ--GKDDIFLDLRQKFWNTYKTGLMYWPFVQLTNFS 142

  Fly   208 WIPTHYRIFYDNI 220
            .:|.::|..|..:
  Rat   143 LVPVNWRTAYTGL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 13/51 (25%)
Mpv17lXP_008765688.1 Mpv17_PMP22 106..165 CDD:397992 13/52 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.