DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and AT4G27740

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_194504.2 Gene:AT4G27740 / 828888 AraportID:AT4G27740 Length:105 Species:Arabidopsis thaliana


Alignment Length:97 Identity:35/97 - (36%)
Similarity:52/97 - (53%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNC 76
            |..:.|..|...|.....|||.:|.||:|.|::|...:|:.......|.::||.::|.||||..|
plant     7 LPTYFCRNCENPLALGEDLISKKFVGASGPAFMFSHAMNVVVGPKIGRKLITGSYVVADVMCSKC 71

  Fly    77 GAKLGWMYEFATEESQKYKEGRVILEYALITE 108
            |..|||.|....:..|:||||..::|...:|:
plant    72 GETLGWKYVETFDLKQRYKEGMFVIEKLKLTK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 33/91 (36%)
AT4G27740NP_194504.2 RLR_C_like 9..102 CDD:416942 33/92 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.