DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and AT3G55890

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001325433.1 Gene:AT3G55890 / 824755 AraportID:AT3G55890 Length:121 Species:Arabidopsis thaliana


Alignment Length:102 Identity:47/102 - (46%)
Similarity:67/102 - (65%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGR 65
            |||:|:..|.| .::.|..|.|:|:....::|..|....||||||..|||::....::|:|:||.
plant     1 MGRVFMVDLEG-NIYICKLCKTHLSTDQDIMSKSFQCKNGRAYLFNNVVNVSVGEKEDRMMITGL 64

  Fly    66 HMVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVILE 102
            |.|.|:.|..||:.:||.||||.|:|||||||:.:||
plant    65 HNVVDIFCVGCGSNVGWKYEFAHEKSQKYKEGKSVLE 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 41/88 (47%)
AT3G55890NP_001325433.1 RLR_C_like 16..106 CDD:416942 41/86 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.