DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and AT3G11230

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001078135.1 Gene:AT3G11230 / 820293 AraportID:AT3G11230 Length:162 Species:Arabidopsis thaliana


Alignment Length:102 Identity:48/102 - (47%)
Similarity:68/102 - (66%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGR 65
            |||:||.:|.| |.::|..|.|||.....::|..|....|:||||.:|||:.....::|:|:||.
plant    34 MGRLFLVNLEG-KSYSCKHCKTNLALCDDVVSKSFQSRHGKAYLFSKVVNVYAGKKEDRMMMTGM 97

  Fly    66 HMVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVILE 102
            |.|.|:.|..||:.:||.||||.|::||||||:.:||
plant    98 HTVVDIYCVKCGSYVGWKYEFAFEKNQKYKEGKSVLE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 40/88 (45%)
AT3G11230NP_001078135.1 RLR_C_like 47..134 CDD:300620 38/86 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.