DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and AT2G40110

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_181540.1 Gene:AT2G40110 / 818600 AraportID:AT2G40110 Length:130 Species:Arabidopsis thaliana


Alignment Length:121 Identity:51/121 - (42%)
Similarity:78/121 - (64%) Gaps:3/121 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGR 65
            |||:|:.:|.| |:::|..|.|:|.....:||..|....|:||||.:|.|::....:||:|:||:
plant     1 MGRLFVVNLEG-KIYSCKHCKTHLATYEDIISKSFHCKHGKAYLFNKVANVSIGETEERLMMTGK 64

  Fly    66 HMVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVILEYALITEAEGFPSEAATTSH 121
            |.|.|:.|.:||:.:||.||.|.|::||||||:.:||...|:..:|  |....:||
plant    65 HTVADIFCVSCGSIVGWKYETAHEKNQKYKEGKSVLERFKISGPDG--SNYWVSSH 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 39/91 (43%)
AT2G40110NP_181540.1 RLR_C_like 13..106 CDD:416942 39/92 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41097
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.