DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and Ypel3

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001366222.1 Gene:Ypel3 / 66090 MGIID:1913340 Length:119 Species:Mus musculus


Alignment Length:88 Identity:47/88 - (53%)
Similarity:58/88 - (65%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCGAK 79
            ::||.|..:|.|...|||..|.|:.||||||..|||:.....:|||:|||.|.|.|:.|:||...
Mouse    21 YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTT 85

  Fly    80 LGWMYEFATEESQKYKEGRVILE 102
            |||.||.|.|.|||||||:.|:|
Mouse    86 LGWKYEQAFESSQKYKEGKYIIE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 47/88 (53%)
Ypel3NP_001366222.1 RLR_C_like 21..110 CDD:416942 47/88 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2192
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.