DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ype and Ypel3

DIOPT Version :10

Sequence 1:NP_572882.1 Gene:Ype / 32295 FlyBaseID:FBgn0288857 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_079623.1 Gene:Ypel3 / 66090 MGIID:1913340 Length:119 Species:Mus musculus


Alignment Length:88 Identity:47/88 - (53%)
Similarity:58/88 - (65%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCGAK 79
            ::||.|..:|.|...|||..|.|:.||||||..|||:.....:|||:|||.|.|.|:.|:||...
Mouse    21 YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTT 85

  Fly    80 LGWMYEFATEESQKYKEGRVILE 102
            |||.||.|.|.|||||||:.|:|
Mouse    86 LGWKYEQAFESSQKYKEGKYIIE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YpeNP_572882.1 RLR_C_like 14..107 CDD:472430 47/88 (53%)
Ypel3NP_079623.1 RLR_C_like 21..110 CDD:472430 47/88 (53%)

Return to query results.
Submit another query.