DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and slc30a10

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001121706.2 Gene:slc30a10 / 555724 ZFINID:ZDB-GENE-060608-2 Length:385 Species:Danio rerio


Alignment Length:118 Identity:27/118 - (22%)
Similarity:41/118 - (34%) Gaps:41/118 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 STRFTGATGRAYLFKRVVN------LTFSNIQER---------------VMLTGR-----HMVRD 70
            |.||:...|||.:...:.|      |.||...|.               |::.|.     ::|..
Zfish    66 SGRFSFGLGRAEVVGALANAVFLIALCFSISMESLKRLAMPQAIDDAPLVLIVGSLGLAVNLVGL 130

  Fly    71 VMCKNCGAKLGWMYEFATEESQKYKEGRVILEYAL----------ITEAEGFP 113
            |:.::||...|     ...:.:|.:|.|...|..|          .||.:|.|
Zfish   131 VIFQDCGRLCG-----RRGKEKKREEHREDREQELEQVETGLQEEKTEKDGAP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 23/110 (21%)
slc30a10NP_001121706.2 CzcD 10..330 CDD:224151 27/118 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.