DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and ypel1

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001003780.1 Gene:ypel1 / 554488 ZFINID:ZDB-GENE-040808-41 Length:119 Species:Danio rerio


Alignment Length:100 Identity:48/100 - (48%)
Similarity:64/100 - (64%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCG 77
            :.::|..|..:|.|..:|||..|.|:.||||||..|||:.....:|||:|||.|.|.|:.|:||.
Zfish    19 RTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCK 83

  Fly    78 AKLGWMYEFATEESQKYKEGRVILEYALITEAEGF 112
            ..|||.||.|.|.|||||||:.|:|.|.:.:..|:
Zfish    84 TTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGW 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 47/91 (52%)
ypel1NP_001003780.1 RLR_C_like 20..108 CDD:416942 45/87 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2192
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.