DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and ypel1

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001016705.1 Gene:ypel1 / 549459 XenbaseID:XB-GENE-998682 Length:119 Species:Xenopus tropicalis


Alignment Length:100 Identity:48/100 - (48%)
Similarity:64/100 - (64%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCG 77
            :.::|..|..:|.|..:|||..|.|:.||||||..|||:.....:|||:|||.|.|.|:.|:||.
 Frog    19 RTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCK 83

  Fly    78 AKLGWMYEFATEESQKYKEGRVILEYALITEAEGF 112
            ..|||.||.|.|.|||||||:.|:|.|.:.:..|:
 Frog    84 TTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGW 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 47/91 (52%)
ypel1NP_001016705.1 RLR_C_like 20..108 CDD:416942 45/87 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.