DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and YPEL5

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001120871.1 Gene:YPEL5 / 51646 HGNCID:18329 Length:121 Species:Homo sapiens


Alignment Length:119 Identity:87/119 - (73%)
Similarity:104/119 - (87%) Gaps:4/119 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGR 65
            ||||||:|:||.:||:||.|.|.|||||:|||||||||||||:||.:||||.:|.:|:|||||||
Human     1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGR 65

  Fly    66 HMVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVILEYALITEAEGF----PSE 115
            ||||||.||||.:||||:||||||:||:|||||||||.||:.|:|||    ||:
Human    66 HMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 71/91 (78%)
YPEL5NP_001120871.1 RLR_C_like 15..107 CDD:416942 71/91 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156837
Domainoid 1 1.000 156 1.000 Domainoid score I4197
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41097
Inparanoid 1 1.050 186 1.000 Inparanoid score I3942
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 1 1.000 - - oto90060
orthoMCL 1 0.900 - - OOG6_100480
Panther 1 1.100 - - LDO PTHR13848
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2192
SonicParanoid 1 1.000 - - X5749
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.