DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and Ypel4

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001019540.1 Gene:Ypel4 / 502643 RGDID:1560142 Length:127 Species:Rattus norvegicus


Alignment Length:100 Identity:43/100 - (43%)
Similarity:63/100 - (63%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCG 77
            :.::|..|..:|....:|||..|.|:.||||||..|||:.....::|::|||.|.|.|:.|::|.
  Rat    27 RTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSVVNVGCGPAEQRLLLTGLHSVADIFCESCK 91

  Fly    78 AKLGWMYEFATEESQKYKEGRVILEYALITEAEGF 112
            ..|||.||.|.|.|||||||:.|:|.:.:.:..|:
  Rat    92 TTLGWKYEQAFETSQKYKEGKYIIEMSHMVKDNGW 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 42/91 (46%)
Ypel4NP_001019540.1 RLR_C_like 28..118 CDD:416942 42/89 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.