powered by:
Protein Alignment Yippee and l(2)37Bb
DIOPT Version :9
Sequence 1: | NP_572882.1 |
Gene: | Yippee / 32295 |
FlyBaseID: | FBgn0026749 |
Length: | 121 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_536791.1 |
Gene: | l(2)37Bb / 49427 |
FlyBaseID: | FBgn0002021 |
Length: | 515 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 14/47 - (29%) |
Similarity: | 23/47 - (48%) |
Gaps: | 5/47 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 IFL--EHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRV 48
||: :.||| .:.|.|..|...| |.:|..::.....|.:|:.|:
Fly 379 IFIRRDGLGG--NYICVQDSTEEYN-SAMIDPQYFAQHIRPHLYNRI 422
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45456413 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.