DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and AT4G27745

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001031733.1 Gene:AT4G27745 / 3770406 AraportID:AT4G27745 Length:106 Species:Arabidopsis thaliana


Alignment Length:100 Identity:42/100 - (42%)
Similarity:59/100 - (59%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKN 75
            |.:|::|..|..::.....:||..|.|.||||:||...:|:.....::|.:|||.|.|.|:.|.:
plant     6 GPRLYSCCNCRNHVGLHDDIISKAFQGRTGRAFLFSHAMNIVVGPKEDRNLLTGLHTVADISCVD 70

  Fly    76 CGAKLGWMYEFATEESQKYKEGRVILEYALITEAE 110
            |...|||.||.|.|.|||||||:.|.|.|.|.:.:
plant    71 CNEPLGWKYERAYETSQKYKEGKFIFEKAKIVKED 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 39/91 (43%)
AT4G27745NP_001031733.1 RLR_C_like 10..101 CDD:416942 39/90 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 1 1.100 - - O PTHR13848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.