DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and Sardh

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_611263.1 Gene:Sardh / 37026 FlyBaseID:FBgn0034276 Length:894 Species:Drosophila melanogaster


Alignment Length:95 Identity:21/95 - (22%)
Similarity:39/95 - (41%) Gaps:23/95 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCGAK 79
            |.|.:...:...::.:.:.|..|      |.||:|.||   ::::|.:.|...|    .:| |..
  Fly   766 FTCRKTGADYRGKAAIENQRAEG------LKKRLVYLT---LRDQVPIWGLEGV----YRN-GEP 816

  Fly    80 LG------WMYEFATEESQKY---KEGRVI 100
            :|      :.|.......|.|   .:|::|
  Fly   817 VGILRRAEYAYTLGKSLGQTYVSRPDGKII 846

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 21/95 (22%)
SardhNP_611263.1 DadA 33..412 CDD:223737
NADB_Rossmann 37..>76 CDD:304358
nuc_hydro 203..>281 CDD:294156
FAO_M 398..449 CDD:292961
GcvT 446..884 CDD:223481 21/95 (22%)