DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and CG6415

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_609441.1 Gene:CG6415 / 34474 FlyBaseID:FBgn0032287 Length:405 Species:Drosophila melanogaster


Alignment Length:68 Identity:18/68 - (26%)
Similarity:27/68 - (39%) Gaps:8/68 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVILEY 103
            ||:|.|.:.....:|.     ..|.|...||...|...|.. |.....|:.::||..|.  :||.
  Fly   192 TGKASLDQLYFMSSFV-----TTLAGIPNVRITRCGYTGED-GVEISVASSQAQKLTES--LLES 248

  Fly   104 ALI 106
            .::
  Fly   249 GVL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 18/68 (26%)
CG6415NP_609441.1 PLN02319 3..403 CDD:177953 18/68 (26%)
GCV_T 31..288 CDD:279857 18/68 (26%)
GCV_T_C 298..392 CDD:285832
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.