DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and Ypel3

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:XP_038963272.1 Gene:Ypel3 / 293491 RGDID:1564579 Length:148 Species:Rattus norvegicus


Alignment Length:88 Identity:47/88 - (53%)
Similarity:58/88 - (65%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCGAK 79
            ::||.|..:|.|...|||..|.|:.||||||..|||:.....:|||:|||.|.|.|:.|:||...
  Rat    50 YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTT 114

  Fly    80 LGWMYEFATEESQKYKEGRVILE 102
            |||.||.|.|.|||||||:.|:|
  Rat   115 LGWKYEQAFESSQKYKEGKYIIE 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 47/88 (53%)
Ypel3XP_038963272.1 RLR_C_like 50..139 CDD:416942 47/88 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.