DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and SPAPJ691.02

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_594895.1 Gene:SPAPJ691.02 / 2543316 PomBaseID:SPAPJ691.02 Length:131 Species:Schizosaccharomyces pombe


Alignment Length:102 Identity:41/102 - (40%)
Similarity:57/102 - (55%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGR 65
            |||.:..||.. :.:.||:|.|:|..:..|:|..:.|..|.|.|||||.|:.....:...|.|||
pombe     1 MGRYYPVHLKS-RCYVCAKCKTHLAFKGHLLSHDYRGKNGPACLFKRVENVIEMEPKTEQMSTGR 64

  Fly    66 HMVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVILE 102
            .:||.:.|..|...:||.|..:.|.|||:|:|..|||
pombe    65 FIVRHIHCCRCHTYIGWKYVSSYEPSQKFKDGHYILE 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 36/88 (41%)
SPAPJ691.02NP_594895.1 RLR_C_like 13..102 CDD:300620 36/89 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 79 1.000 Domainoid score I2356
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I1837
OMA 1 1.010 - - QHG53853
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 1 1.000 - - otm47264
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2192
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.