DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and B0546.3

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001294508.1 Gene:B0546.3 / 182030 WormBaseID:WBGene00015250 Length:427 Species:Caenorhabditis elegans


Alignment Length:112 Identity:62/112 - (55%)
Similarity:76/112 - (67%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGR 65
            ||..|.|:.||||:|.|..|.|.|.::..|:||.|||.||:|:|||.|.|:.|.....|.||||.
 Worm     1 MGLKFFENAGGLKMFFCTNCDTYLADKGHLVSTSFTGTTGQAFLFKNVTNVKFGESVVRNMLTGA 65

  Fly    66 HMVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVILEYALITEAEGF 112
            |.||||.|::|.|:||||||.|..:::|||||.||||...|||.|.|
 Worm    66 HFVRDVFCQSCRAQLGWMYELAPNDNEKYKEGSVILERMNITEREAF 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 49/91 (54%)
B0546.3NP_001294508.1 RLR_C_like 15..107 CDD:386805 49/91 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164761
Domainoid 1 1.000 109 1.000 Domainoid score I4009
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto19542
orthoMCL 1 0.900 - - OOG6_100480
Panther 1 1.100 - - LDO PTHR13848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5749
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.