DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and F37A8.5

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_497796.1 Gene:F37A8.5 / 175512 WormBaseID:WBGene00009503 Length:137 Species:Caenorhabditis elegans


Alignment Length:114 Identity:49/114 - (42%)
Similarity:69/114 - (60%) Gaps:1/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RIFLEHL-GGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRH 66
            :.|..:| .|.:.::|..|..||...::|||..|.|:.|:||||..|||:.....:|||:|||.|
 Worm    21 KTFQHYLPAGDRCYSCIHCRANLAAHAELISKSFQGSQGKAYLFNAVVNVGCGPAEERVLLTGLH 85

  Fly    67 MVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVILEYALITEAEGFPSE 115
            .|.|:.|:.|...|||.||.|.|.|||||||:.|:|.|.:.:..|:..:
 Worm    86 AVADIYCEICKTTLGWKYEHAFESSQKYKEGKFIIELAHMVKDNGWDEQ 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 45/91 (49%)
F37A8.5NP_497796.1 RLR_C_like 33..123 CDD:300620 44/89 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2192
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.