DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yippee and Ypel1

DIOPT Version :9

Sequence 1:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster
Sequence 2:XP_002727960.1 Gene:Ypel1 / 100360867 RGDID:2321291 Length:118 Species:Rattus norvegicus


Alignment Length:108 Identity:50/108 - (46%)
Similarity:67/108 - (62%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVR 69
            :|.|..  :.::|..|..:|.|..:|||..|.|:.||||||..|||:.....:|||:|||.|.|.
  Rat    13 YLPHCH--RTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVA 75

  Fly    70 DVMCKNCGAKLGWMYEFATEESQKYKEGRVILEYALITEAEGF 112
            |:.|:||...|||.||.|.|.|||||||:.|:|.|.:.:..|:
  Rat    76 DIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGW 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 47/91 (52%)
Ypel1XP_002727960.1 RLR_C_like 20..108 CDD:416942 45/87 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.