DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and TIM9

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_190240.1 Gene:TIM9 / 823809 AraportID:AT3G46560 Length:93 Species:Arabidopsis thaliana


Alignment Length:76 Identity:32/76 - (42%)
Similarity:42/76 - (55%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRF 74
            ||||   |::   |.|..||.|.|.||.||:..||.:.::..||.|.:.|.||:||...||..||
plant    24 IDQL---QLR---DSLRMYNSLVERCFVDCVDSFTRKSLQKQEETCVMRCAEKFLKHTMRVGMRF 82

  Fly    75 QEFQVIAHENA 85
            .|.    ::||
plant    83 AEL----NQNA 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 23/56 (41%)
TIM9NP_190240.1 zf-Tim10_DDP 23..82 CDD:397210 27/63 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3961
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2559
OMA 1 1.010 - - QHG57731
OrthoDB 1 1.010 - - D1627953at2759
OrthoFinder 1 1.000 - - FOG0003905
OrthoInspector 1 1.000 - - oto3427
orthoMCL 1 0.900 - - OOG6_103037
Panther 1 1.100 - - O PTHR13172
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3208
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.