DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and timm10b

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001017829.1 Gene:timm10b / 550527 ZFINID:ZDB-GENE-050417-370 Length:202 Species:Danio rerio


Alignment Length:90 Identity:29/90 - (32%)
Similarity:45/90 - (50%) Gaps:12/90 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQR------------ 69
            |::...|||:.||:::|.||..|..:|..|::...||:|..:|..|.::.|.|            
Zfish     6 QLRNLRDFLLVYNRMTEICFHRCSSNFNYRNLTMDEERCVDSCAGKLIRTNHRLMGTYVQLMPAM 70

  Fly    70 VSQRFQEFQVIAHENALAMAQKTGK 94
            |.:|.||.:..|.|.|.|.|:...|
Zfish    71 VQKRMQEMESKAAEMAKAEAEAAAK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 20/68 (29%)
timm10bNP_001017829.1 zf-Tim10_DDP 6..63 CDD:281019 19/56 (34%)
Twin CX3C motif 24..48 8/23 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..202
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.