DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and timm9

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001153383.1 Gene:timm9 / 282678 ZFINID:ZDB-GENE-021206-14 Length:89 Species:Danio rerio


Alignment Length:88 Identity:46/88 - (52%)
Similarity:62/88 - (70%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQ 72
            :|....:.||||.|.:||.:||||:|.||.||::|||||:||..|..||.:|::|||||.||:|.
Zfish     1 MAAQVTESDQIKQFKEFLGTYNKLTENCFMDCVKDFTTREVKPEETTCSESCLQKYLKMTQRISM 65

  Fly    73 RFQEFQVIAHENALAMAQKTGKL 95
            ||||:.:..:|   |:|.|.|.|
Zfish    66 RFQEYHIQQNE---ALAAKAGLL 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 34/56 (61%)
timm9NP_001153383.1 zf-Tim10_DDP 10..67 CDD:281019 34/56 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589133
Domainoid 1 1.000 89 1.000 Domainoid score I7848
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40847
Inparanoid 1 1.050 96 1.000 Inparanoid score I5042
OMA 1 1.010 - - QHG57731
OrthoDB 1 1.010 - - D1627953at2759
OrthoFinder 1 1.000 - - FOG0003905
OrthoInspector 1 1.000 - - oto40042
orthoMCL 1 0.900 - - OOG6_103037
Panther 1 1.100 - - LDO PTHR13172
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1524
SonicParanoid 1 1.000 - - X3208
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.