DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and TIMM9

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001291414.1 Gene:TIMM9 / 26520 HGNCID:11819 Length:89 Species:Homo sapiens


Alignment Length:94 Identity:49/94 - (52%)
Similarity:65/94 - (69%) Gaps:11/94 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKM 66
            |:.||:        ||||.|.:||.:||||:||||.||::|||||:||..|..||.:|::|||||
Human     3 AQIPES--------DQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKM 59

  Fly    67 NQRVSQRFQEFQVIAHENALAMAQKTGKL 95
            .||:|.||||:.:..:|   |:|.|.|.|
Human    60 TQRISMRFQEYHIQQNE---ALAAKAGLL 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 35/56 (63%)
TIMM9NP_001291414.1 zf-Tim10_DDP 10..67 CDD:397210 35/56 (63%)
Twin CX3C motif 28..52 14/23 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154009
Domainoid 1 1.000 91 1.000 Domainoid score I7733
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40847
Inparanoid 1 1.050 100 1.000 Inparanoid score I5004
Isobase 1 0.950 - 0.861654 Normalized mean entropy S713
OMA 1 1.010 - - QHG57731
OrthoDB 1 1.010 - - D1627953at2759
OrthoFinder 1 1.000 - - FOG0003905
OrthoInspector 1 1.000 - - oto91385
orthoMCL 1 0.900 - - OOG6_103037
Panther 1 1.100 - - LDO PTHR13172
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1524
SonicParanoid 1 1.000 - - X3208
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.