DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and TIMM10B

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_036324.1 Gene:TIMM10B / 26515 HGNCID:4022 Length:103 Species:Homo sapiens


Alignment Length:91 Identity:23/91 - (25%)
Similarity:40/91 - (43%) Gaps:12/91 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQR------- 69
            |..:.|::...|||:.||:::|.||..|:.....|.:...||.|..:|..|.:..|.|       
Human     5 QQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQ 69

  Fly    70 -----VSQRFQEFQVIAHENALAMAQ 90
                 |.:|..:::..:....:|..|
Human    70 LMPALVQRRIADYEAASAVPGVAAEQ 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 19/68 (28%)
TIMM10BNP_036324.1 zf-Tim10_DDP 12..67 CDD:281019 17/54 (31%)
Twin CX3C motif 28..52 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.861654 Normalized mean entropy S713
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.