DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and tim9

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_588008.1 Gene:tim9 / 2539125 PomBaseID:SPCC24B10.05 Length:84 Species:Schizosaccharomyces pombe


Alignment Length:74 Identity:28/74 - (37%)
Similarity:45/74 - (60%) Gaps:6/74 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIA 81
            :.|...::|..|:.|::.||:||::|||:..:.:.|.:|...|.:|:||.::||.|||.||    
pombe    17 EAKQLKEYLNMYSTLTQNCFSDCVQDFTSSKLSNKESECIAKCADKFLKHSERVGQRFAEF---- 77

  Fly    82 HENALAMAQ 90
              ||..|.|
pombe    78 --NAKYMGQ 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 20/56 (36%)
tim9NP_588008.1 zf-Tim10_DDP 14..74 CDD:281019 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I2994
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I1973
OMA 1 1.010 - - QHG57731
OrthoFinder 1 1.000 - - FOG0003905
OrthoInspector 1 1.000 - - oto101965
orthoMCL 1 0.900 - - OOG6_103037
Panther 1 1.100 - - LDO PTHR13172
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1524
SonicParanoid 1 1.000 - - X3208
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.