DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and tin-9.2

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001379430.1 Gene:tin-9.2 / 24105311 WormBaseID:WBGene00044083 Length:111 Species:Caenorhabditis elegans


Alignment Length:77 Identity:26/77 - (33%)
Similarity:38/77 - (49%) Gaps:7/77 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAH 82
            |:...:||..||.|||.||..|.||:||..:...|..|...|::|.:.:|:|       |.::..
 Worm     7 IQQLREFLTVYNTLSERCFNACARDYTTSTLTKDEGSCVSQCIDKQMLVNRR-------FMLVFA 64

  Fly    83 ENALAMAQKTGK 94
            |.|.....|.|:
 Worm    65 EQAPKALFKQGE 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 21/55 (38%)
tin-9.2NP_001379430.1 zf-Tim10_DDP 4..63 CDD:397210 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627953at2759
OrthoFinder 1 1.000 - - FOG0003905
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13172
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.