DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and tin-9.1

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001021307.1 Gene:tin-9.1 / 177475 WormBaseID:WBGene00006572 Length:78 Species:Caenorhabditis elegans


Alignment Length:75 Identity:38/75 - (50%)
Similarity:51/75 - (68%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQV 79
            :..|:||.|||..||.::|.||..|:.:|.:|.|...||.|:.||::|:|||.|||||||||.|:
 Worm     4 EQNIQTFRDFLTQYNLVAEQCFNSCVNEFGSRTVSGKEESCANNCLDKFLKMTQRVSQRFQEHQL 68

  Fly    80 I-AHENALAM 88
            : |..|..||
 Worm    69 LNAQANGAAM 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 29/56 (52%)
tin-9.1NP_001021307.1 zf-Tim10_DDP 5..63 CDD:281019 29/57 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163328
Domainoid 1 1.000 78 1.000 Domainoid score I5702
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I3762
Isobase 1 0.950 - 0.861654 Normalized mean entropy S713
OMA 1 1.010 - - QHG57731
OrthoDB 1 1.010 - - D1627953at2759
OrthoFinder 1 1.000 - - FOG0003905
OrthoInspector 1 1.000 - - oto18233
orthoMCL 1 0.900 - - OOG6_103037
Panther 1 1.100 - - LDO PTHR13172
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1524
SonicParanoid 1 1.000 - - X3208
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.