DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and Timm9

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001263358.1 Gene:Timm9 / 171139 RGDID:621656 Length:89 Species:Rattus norvegicus


Alignment Length:94 Identity:49/94 - (52%)
Similarity:65/94 - (69%) Gaps:11/94 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKM 66
            |:.||:        ||||.|.:||.:||||:||||.||::|||||:||..|..||.:|::|||||
  Rat     3 AQIPES--------DQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEEVTCSEHCLQKYLKM 59

  Fly    67 NQRVSQRFQEFQVIAHENALAMAQKTGKL 95
            .||:|.||||:.:..:|   |:|.|.|.|
  Rat    60 TQRISMRFQEYHIQQNE---ALAAKAGLL 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 35/56 (63%)
Timm9NP_001263358.1 zf-Tim10_DDP 10..67 CDD:397210 35/56 (63%)
Twin CX3C motif 28..52 14/23 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347605
Domainoid 1 1.000 91 1.000 Domainoid score I7552
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40847
Inparanoid 1 1.050 100 1.000 Inparanoid score I4902
OMA 1 1.010 - - QHG57731
OrthoDB 1 1.010 - - D1627953at2759
OrthoFinder 1 1.000 - - FOG0003905
OrthoInspector 1 1.000 - - oto98465
orthoMCL 1 0.900 - - OOG6_103037
Panther 1 1.100 - - LDO PTHR13172
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3208
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.