DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and Timm10b

DIOPT Version :10

Sequence 1:NP_572881.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001346981.1 Gene:Timm10b / 14356 MGIID:1315196 Length:109 Species:Mus musculus


Alignment Length:56 Identity:18/56 - (32%)
Similarity:30/56 - (53%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRV 70
            :.|::...|||:.||:::|.||..|:.....|.:...||.|..:|..|.:..|.|:
Mouse     5 QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRL 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_572881.1 zf-Tim10_DDP 17..76 CDD:460764 18/54 (33%)
Timm10bNP_001346981.1 zf-Tim10_DDP 9..64 CDD:460764 17/52 (33%)

Return to query results.
Submit another query.