DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1640 and KYAT1

DIOPT Version :9

Sequence 1:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001274319.1 Gene:KYAT1 / 883 HGNCID:1564 Length:516 Species:Homo sapiens


Alignment Length:421 Identity:89/421 - (21%)
Similarity:155/421 - (36%) Gaps:71/421 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 PDYPEDVKKRACA---ILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGG 239
            ||:..:..:.|.:   :||        .||.:.|...:.:.:|.:..:..|......:::.:|.|
Human   137 PDFAVEAFQHAVSGDFMLN--------QYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVG 193

  Fly   240 ASPGIKSILSMINAEVGCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLE----------EETGW 294
               |..::.:...|.|. :...|::..|.:..|.......|...|...|:          ..:.|
Human   194 ---GYGALFTAFQALVD-EGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNW 254

  Fly   295 SLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNV 359
            .||..||...:....|     |||:..|.||.|:|.:||.:|.:......:.|:.:.|||||..|
Human   255 QLDPMELAGKFTSRTK-----ALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMV 314

  Fly   360 YDKNSKFWSFKKVAYEMGDPYRNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSIT 424
            ||.:...    .:|...|...|.|.:.|...|    ....|.:.|:  ||..|..:|.:.|....
Human   315 YDGHQHI----SIASLPGMWERTLTIGSAGKT----FSATGWKVGW--VLGPDHIMKHLRTVHQN 369

  Fly   425 AALCSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPV-- 487
            :.....|..|.||:      :..|....|:::.....:...:.........:.|.:...:.|:  
Human   370 SVFHCPTQSQAAVA------ESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIP 428

  Fly   488 QGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFE----------LLETSGICIVPGSGFGQKPGT 542
            ||:.::...|         :..|...||:..|.:          :::..|:..:|.|.|...|..
Human   429 QGSYFLITDI---------SDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQ 484

  Fly   543 WHF----RSTILPQTDKLKLMMEKFRVFHAE 569
            .||    |...:.....|:.|.||.|.:..|
Human   485 KHFDHYIRFCFVKDEATLQAMDEKLRKWKVE 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 89/421 (21%)
AAT_like 178..564 CDD:99734 87/414 (21%)
KYAT1NP_001274319.1 Aminotran_1_2 118..512 CDD:332562 88/416 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158205
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.