DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1640 and ACCS

DIOPT Version :9

Sequence 1:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_005253227.2 Gene:ACCS / 84680 HGNCID:23989 Length:602 Species:Homo sapiens


Alignment Length:417 Identity:94/417 - (22%)
Similarity:162/417 - (38%) Gaps:112/417 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SFSTSHKMPSSSK---ALTLDNINPNFIAMEYAV-----RGPLVIRAGEIEKELEKGVKKPFDQV 143
            |:...||.|.:.:   |||.:.:..:.:...:.:     |.|.........::|.....:..:  
Human    72 SYPLHHKTPRTPRQYSALTQEILTWHLVIEMFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLE-- 134

  Fly   144 IRANIGDCHAMGQQPLTFLRQL---LALTFETRLLDS---------------------PDYPEDV 184
                 |:|.....|.|..||.:   ..::.:|..|.|                     .:|.|| 
Human   135 -----GECSRKLDQKLPELRGVGDPAMISSDTSYLSSRGRMIKWFWDSAEEGYRTYHMDEYDED- 193

  Fly   185 KKRACAILNGCQGQ----------------------SVGSYTDSAGLEVVRRQVAQY-------- 219
             |....|:|....:                      |:..|.|..|...:|.:||::        
Human   194 -KNPSGIINLGTSENKLCFDLLSWRLSQRDMQRVEPSLLQYADWRGHLFLREEVAKFLSFYCKSP 257

  Fly   220 IEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEVGCKAPGVMVPIPQYPLYSATISEYGMTKV 284
            :..|...:      :.|.||||  :.|.|:.:..|.|   ...::|.|.|...:..:..||..::
Human   258 VPLRPENV------VVLNGGAS--LFSALATVLCEAG---EAFLIPTPYYGAITQHVCLYGNIRL 311

  Fly   285 DY-YLEEE-TGWSLDRK-----------ELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIE 336
            .| ||:.| ||  ||.:           .|:.::.|..||   :.|::|:|.||.|.|.:.|.::
Human   312 AYVYLDSEVTG--LDTRPFQLTVEKLEMALREAHSEGVKV---KGLILISPQNPLGDVYSPEELQ 371

  Fly   337 EIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPYRNLEMVSFLSTSKGYLGECGI 401
            |.:.||..:::.|:.||||..:|::|:..:.|...:. .:.||.|...|   .:|||.: |..|:
Human   372 EYLVFAKRHRLHVIVDEVYMLSVFEKSVGYRSVLSLE-RLPDPQRTHVM---WATSKDF-GMSGL 431

  Fly   402 RGGYMEVLNLDPKVKAMLTKSITAALC 428
            |.|.:...|.|       ..:..|:||
Human   432 RFGTLYTENQD-------VATAVASLC 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 90/405 (22%)
AAT_like 178..564 CDD:99734 75/294 (26%)
ACCSXP_005253227.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158202
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.