DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1640 and AT1G17300

DIOPT Version :10

Sequence 1:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001320458.1 Gene:AT1G17300 / 838302 AraportID:AT1G17300 Length:146 Species:Arabidopsis thaliana


Alignment Length:82 Identity:24/82 - (29%)
Similarity:36/82 - (43%) Gaps:13/82 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LHNNSNNANRRAAKST--ATATVTAAATSQRHGTSGDFIQPLDVRRSFSTSHKMPSSSKALTLDN 105
            :..:...|:.|..|.:  ...|.|.|::|:....|...|...|           .|||..:|||:
plant    72 IDKDQEKASVRGEKDSFRRVPTPTPASSSRHLSASSSDISASD-----------SSSSLPVTLDS 125

  Fly   106 INPNFIAMEYAVRGPLV 122
            ||...:..||||||.::
plant   126 INTKVLKYEYAVRGEII 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 11/24 (46%)
AT1G17300NP_001320458.1 PLN02231 119..>146 CDD:177876 11/24 (46%)

Return to query results.
Submit another query.