DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1640 and Kyat1

DIOPT Version :9

Sequence 1:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_006498378.1 Gene:Kyat1 / 70266 MGIID:1917516 Length:573 Species:Mus musculus


Alignment Length:435 Identity:93/435 - (21%)
Similarity:153/435 - (35%) Gaps:115/435 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 DVKKRACAILNGCQGQSVGSYTD-------SAGLEVVRRQVAQ----YIEKRD-------GGIAS 229
            ||.:|.|..:.||:....| :|:       |..|..:..:||.    ..:..|       .|:|.
Mouse   141 DVTERKCLGILGCRPVFKG-HTELRTASDSSLELSCIWAEVAHLGLGLFKGTDFCNLGNTFGVAG 204

  Fly   230 NWQD---IYLTGGASPGIKSILSMINAEVGCK---APGVMVPIPQY----PLYSATISE------ 278
            .|.:   ..|..|..|..|.:.|.....:|.:   ...|:|.:..|    ..:.|.:.|      
Mouse   205 YWTEQRYCLLKQGYPPLTKILASFFGKLLGQEMDPLKNVLVTVGAYGALFTAFQALVDEGDEVII 269

  Fly   279 --------YGMTKV----------------DYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVV 319
                    ..||.:                ...|.....|.||..||...:....|:     ||:
Mouse   270 IEPAFNCYEPMTMMAGGRPVFVSLRLSPAPKGQLGSSNDWQLDPTELASKFTPRTKI-----LVL 329

  Fly   320 INPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPYRNLE 384
            ..|.||.|:|.:::.:|.:......:.||..:|||||..|||.:...    .:|...|...|.|.
Mouse   330 NTPNNPLGKVFSKKELELVAALCQQHDVLCFSDEVYQWLVYDGHQHI----SIASLPGMWERTLT 390

  Fly   385 M----VSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALVNPPQ 445
            :    .||.:|        |.:.|:  |:..|..:|.:.|....:.....|..|.||:......|
Mouse   391 IGSAGKSFSAT--------GWKVGW--VMGPDNIMKHLRTVHQNSIFHCPTQAQAAVAQCFEREQ 445

  Fly   446 P--GEP-SYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPV--QGAMYVFPQIEIPPKAIE 505
            .  |:| ||.|...:..|:     .|..::    .|.:...:.|:  ||:.::...|        
Mouse   446 QHFGQPSSYFLQLPQAMGL-----NRDHMI----QSLQSVGLKPLIPQGSYFLIADI-------- 493

  Fly   506 AAKAKGMAPDVFYAFE----------LLETSGICIVPGSGFGQKP 540
             :..|...||:..|.:          :::..|:..:|.|.|..:|
Mouse   494 -SDFKSSMPDLPGAMDEPYDTRFAKWMIKNKGLSAIPVSTFYSQP 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 93/435 (21%)
AAT_like 178..564 CDD:99734 93/435 (21%)
Kyat1XP_006498378.1 PRK08912 218..569 CDD:181580 75/357 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.