DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1640 and TAT

DIOPT Version :9

Sequence 1:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_000344.1 Gene:TAT / 6898 HGNCID:11573 Length:454 Species:Homo sapiens


Alignment Length:435 Identity:100/435 - (22%)
Similarity:156/435 - (35%) Gaps:130/435 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 PFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSY 203
            |...:|..:|||....|..|..                    ||..:....|:.:|    ....|
Human    69 PNKTMISLSIGDPTVFGNLPTD--------------------PEVTQAMKDALDSG----KYNGY 109

  Fly   204 TDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEVGCKAPG--VMVPI 266
            ..|.|....|.::|.|....:..:.:  :|:.||.|.|..|...|:::      ..||  ::||.
Human   110 APSIGFLSSREEIASYYHCPEAPLEA--KDVILTSGCSQAIDLCLAVL------ANPGQNILVPR 166

  Fly   267 PQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLT 331
            |.:.||.......|:....|.|..|..|.:|.|:|:...|| |..|    |:|.||.||.|.|.:
Human   167 PGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDE-KTAC----LIVNNPSNPCGSVFS 226

  Fly   332 RENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKF--------------------------WSFK 370
            :.::::|:..|....|.:||||:|.|.|: .:.|:                          |...
Human   227 KRHLQKILAVAARQCVPILADEIYGDMVF-SDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLG 290

  Fly   371 KV-AYEMGDPYRNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQ 434
            .: .::..|.:.|......:..|:..||.|.|..|.:              |||   ||.|    
Human   291 WILIHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGAL--------------KSI---LCRT---- 334

  Fly   435 VAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYV------ 493
                       |||..::        .|:.||..|:|.:.||.:..|.:.....||||:      
Human   335 -----------PGEFYHN--------TLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEM 380

  Fly   494 --FPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGF 536
              ||:.|               .||.:...|:....:..:|.:.|
Human   381 EHFPEFE---------------NDVEFTERLVAEQSVHCLPATCF 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 100/435 (23%)
AAT_like 178..564 CDD:99734 93/396 (23%)
TATNP_000344.1 TAT_ubiq 1..40 CDD:285008
tyr_amTase_E 41..442 CDD:273529 100/435 (23%)
AAT_like 74..436 CDD:99734 99/430 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.