DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1640 and kyat3.2

DIOPT Version :9

Sequence 1:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_956638.2 Gene:kyat3.2 / 393315 ZFINID:ZDB-GENE-040426-1299 Length:450 Species:Danio rerio


Alignment Length:497 Identity:94/497 - (18%)
Similarity:171/497 - (34%) Gaps:165/497 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IQPLDVRRSFSTSHKMPSSSKALTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPFDQV 143
            :.|:.:.|..|:..::..:::..:..:...|..::::.       .|..|| .|:|.|...|..|
Zfish     1 MHPIHLLRIVSSVRRLLQTNRCRSFSSCQHNMASIKHK-------NARRIE-GLDKNVWVAFTSV 57

  Fly   144 IR----ANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPED--VKKRACAILNGCQGQSVGS 202
            ..    .|:|..:                         ||.|..  ||:   .:........:..
Zfish    58 AADPSIVNLGQGY-------------------------PDIPPPSYVKE---GLAQAAMVDRLNQ 94

  Fly   203 YTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEV------------ 255
            ||...|...:.:.:::...|........:::|.:|.|   |..|:.|.:.|.|            
Zfish    95 YTRGFGHPTLVKALSKVYGKVYDRQLDPFKEILVTVG---GYGSLFSTMQALVEEGDEVIIIEPF 156

  Fly   256 -GCKAPGVMV----PIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPR 315
             .|..|.|.:    |: ..||...:.:..|::..|        |.||::||...::...|     
Zfish   157 FDCYVPMVKMAGAKPV-LIPLRLKSTATTGISSAD--------WVLDQEELASKFNSKTK----- 207

  Fly   316 ALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSK--------FW----- 367
            |:::..|.||.|::.:|..::.|......:..|..:||||:..:|..:..        .|     
Zfish   208 AIIINTPNNPIGKIFSRSELQAIADLCIKHDTLCFSDEVYEWLIYKGHEHVKIATLPGMWDRTIT 272

  Fly   368 ------SFK----KVAYEMGDPY--RNLEMVSFLS-----------TSKGYLGECGIRGG---YM 406
                  :|.    |:.:.:|..:  |:|:.|...|           ..:|.|.:..:.|.   |.
Zfish   273 VGSAGKTFSVTGWKLGWSIGPEHLIRHLQTVMQNSLYTCPTPLQEAVGRGLLRDFELMGQPDCYF 337

  Fly   407 EVLNLD-----PKVKAMLTKSITAALCSTTAGQVAVSALVNPPQPG------------------- 447
            ..|.|:     .::.|||             .|..::.:|  |:.|                   
Zfish   338 SALALELEGKRDRMAAML-------------AQTGMTPVV--PEGGYFMIVDVTALNQDLTHMGD 387

  Fly   448 -EPSYDLYK------KERDGILAALKERAELVHKALNSFEGY 482
             || || ||      ||:.  |||:...|.:...::..||.|
Zfish   388 DEP-YD-YKFVKWMIKEKK--LAAIPVTAFVGEDSVKQFEKY 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 91/477 (19%)
AAT_like 178..564 CDD:99734 80/394 (20%)
kyat3.2NP_956638.2 PRK08912 58..450 CDD:181580 82/432 (19%)
AAT_like 64..445 CDD:99734 82/426 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.